PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG032000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 445aa    MW: 49399.1 Da    PI: 6.1587
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG032000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.41.2e-151258349
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                         +en+snr+vtf kRr g+ K A  LS+L++a++a+ + s+tgk+  +
  Pavir.2NG032000.1.p 12 VENDSNRSVTFFKRRSGLYKAAADLSTLTGARIAIALESETGKMSSF 58
                         79******************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-14161IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-10424IPR002100Transcription factor, MADS-box
CDDcd002662.21E-17474No hitNo description
SuperFamilySSF554559.03E-17573IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.969962IPR002100Transcription factor, MADS-box
PfamPF003199.1E-171258IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-102439IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-103960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MPRPRRSGIS YVENDSNRSV TFFKRRSGLY KAAADLSTLT GARIAIALES ETGKMSSFGT  60
PSAGPIIDSF LSRNIPVDPS VTEEQKVEIT NMQNEVFMAE REKYMEDRRK QVTSARAKEI  120
QETSRKAKLV YGKVEDLSVQ ELNEMVRVFS QIEQEINDGC HPQQPSYQLE VGGSRDAFLG  180
QLSSSSSFSQ IQVPPRRLPW TPRHPSLHLP RSTWSLPQPS RSHSPLLNSS LLPSAHAQPR  240
PLFQHSQMPQ HPLVVEPQVQ RMLSPTETYQ HNYNTQLGMH INGNIPQPFS QSFLNSALPP  300
PPAPPSSSAQ ITFYNEFPPP SFSHELPTPL PIETELHPVE QFENHASPQD ITIDHPFVNH  360
QWPSPIPSNE PYYDISLYGM NLNLGGHGDY GGQAAGEHDM PGPSGLHQQG YDCPYRNFLG  420
SFSSGECPAD YGPGNNLGDM APPQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958932.11e-166PREDICTED: uncharacterized protein LOC101780877
TrEMBLK4A1W61e-166K4A1W6_SETIT; Uncharacterized protein
STRINGSi032862m1e-166(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30892276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.14e-14AGAMOUS-like 61